Translator Disclaimer
1 July 2014 Diverse Families of Antimicrobial Peptides Isolated from Skin Secretions of Three Species of East Asian Frogs, Babina daunchina, Babina adenopleura, and Rana omeimontis (Ranidae)
Author Affiliations +
Abstract

Twenty-two novel cDNAs encoding 22 peptide precursors for 19 mature peptides including antimicrobial peptides (AMPs) were identified from East Asian frog species Babina daunchina, Babina adenopleura, and Rana omeimontis skin-derived cDNA libraries. Two atypical members of the brevinin-1 family AMPs, named brevinin-1AN1 (FLTGVLKLASKIPSVLCAVLKTC) and brevinin-1DN1(FLKGVINLASKIPSMLCAVLKTC), were purified from the skin secretions of B. adenopleura and B. daunchina, respectively. A member of the ranatuerin-2 family AMP named ranatuerin-2DN1 (GLFDSITQGLKDTAVKLLDKIKCKLSACPPA) was also purified from the skin secretion of B. daunchina. One AMP named japonicin-2OM1 (FIVPSIFLLKKAFCIALKKNC) was purified from the skin secretion of R. omeimontis. The antimicrobial tests showed that brevinin-1DN1, brevinin-1DN2, brevinin-1AN1, and japonicin-2OM1 possess higher antimicrobial activity against Gram-positive bacteria than Gram-negative bacteria.

© 2014 Zoological Society of Japan
Yuhong Hu, Shiqi Xu, Yonghong Hu, Chao Guo, Hao Meng, Jing Li, Jingze Liu, and Hui Wang "Diverse Families of Antimicrobial Peptides Isolated from Skin Secretions of Three Species of East Asian Frogs, Babina daunchina, Babina adenopleura, and Rana omeimontis (Ranidae)," Zoological Science 31(7), 438-444, (1 July 2014). https://doi.org/10.2108/zs140014
Received: 19 January 2014; Accepted: 1 March 2014; Published: 1 July 2014
JOURNAL ARTICLE
7 PAGES


SHARE
ARTICLE IMPACT
RIGHTS & PERMISSIONS
Get copyright permission
Back to Top